PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10030677
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 310aa    MW: 33658.4 Da    PI: 9.4827
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10030677genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd llv +++ +G+ +W++I+   g++R+ k+c++rw +yl
      Lus10030677 14 KGPWTPEEDILLVSYIHHHGPSNWRSIPTNTGLRRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.42.6e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++Ed+ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Lus10030677  67 RGNFTPQEDQMIIHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.095961IPR017930Myb domain
SuperFamilySSF466895.75E-3111108IPR009057Homeodomain-like
SMARTSM007172.3E-141363IPR001005SANT/Myb domain
PfamPF002492.0E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-241568IPR009057Homeodomain-like
CDDcd001672.99E-111661No hitNo description
PROSITE profilePS5129425.93462116IPR017930Myb domain
SMARTSM007179.1E-1766114IPR001005SANT/Myb domain
PfamPF002492.4E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-2669116IPR009057Homeodomain-like
CDDcd001674.37E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MGRAPCCDAG GVKKGPWTPE EDILLVSYIH HHGPSNWRSI PTNTGLRRCS KSCRLRWTNY  60
LRPGIKRGNF TPQEDQMIIH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLLNNS  120
PHRVNNGVSD HHQRNSSPAS RTASPSSSAS SSSGSPSRGQ WERRLQTDIH TARQALSEAI  180
SPSLSSAPDL NSSHAPPTAA AAYASSAENI AKLLKGWMKK SKTDDSAAGG ESSQVSGYST  240
VGLAGQSMDL GSGEMNSDSR HTSPYGGYSR KAEEARLSLL EKWLLDEGTA STAGKYEFLS  300
TLMDGDNFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-251411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015879369.11e-104PREDICTED: myb-related protein 306
SwissprotQ9SCU74e-97MYB30_ARATH; Transcription factor MYB30
TrEMBLF6GT801e-102F6GT80_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g06190.t011e-102(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.15e-93myb domain protein 30